KEGG   Helicobacter pylori 51: KHP_1120Help
Entry
KHP_1120          CDS       T02082                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpd  Helicobacter pylori 51
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KHP_1120 (hemD)
Enzymes [BR:hpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KHP_1120 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245587..1246261
Genome map
AA seq 224 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLQ
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFNQAVVYENKLKHLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLEN
YTAISIGNTTALYLKEQGIQSYTAKKPSLEACLELALSLRIKEC
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcctttagaattagatccaaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactccaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagagattgcctct
tctttagacaccattcttttagagcatggcattgatttcaaccaagccgttgtttatgaa
aacaagctcaaacatttaagcgaacaaaacgccctaaaacccaaagaaaagagtattctt
atttttaccgccataagccatgcaaaagccttcttgcactattttgaatttttagaaaat
tacaccgctataagcattggcaacacgaccgctctttatttaaaagagcaaggcattcaa
agttataccgctaaaaagccctccttagaagcgtgtttagagctggctttgagtttgaga
attaaggaatgttaa

DBGET integrated database retrieval system