KEGG   Helicobacter pylori 51: KHP_1120Help
Entry
KHP_1120          CDS       T02082                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpd  Helicobacter pylori 51
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245587..1246261
Genome map
AA seq 224 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLQ
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFNQAVVYENKLKHLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLEN
YTAISIGNTTALYLKEQGIQSYTAKKPSLEACLELALSLRIKEC
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattttgctactatcctttagaattagatccaaccccttttaacgcccttattttc
acttctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactccaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatctcagggcaaaagagattgcctct
tctttagacaccattcttttagagcatggcattgatttcaaccaagccgttgtttatgaa
aacaagctcaaacatttaagcgaacaaaacgccctaaaacccaaagaaaagagtattctt
atttttaccgccataagccatgcaaaagccttcttgcactattttgaatttttagaaaat
tacaccgctataagcattggcaacacgaccgctctttatttaaaagagcaaggcattcaa
agttataccgctaaaaagccctccttagaagcgtgtttagagctggctttgagtttgaga
attaaggaatgttaa

DBGET integrated database retrieval system