KEGG   Helicobacter pylori ELS37: HPELS_00585Help
Entry
HPELS_00585       CDS       T01798                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPELS_00585
Enzymes [BR:hpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPELS_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
117951..118589
Genome map
AA seq 212 aa AA seqDB search
MLNMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASQDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcgcaaatcaatttgtgatcaacaaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
caggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaattacaagagagcaaaaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagggagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgacgatccacgattgagcgtgtaa

DBGET integrated database retrieval system