KEGG   Helicobacter pylori ELS37: HPELS_00825Help
Entry
HPELS_00825       CDS       T01798                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167384..168355)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNEINSMPGVYQMSMEPLL
KECEELVELGIKAVLLFGIPKHKDAAGSHALNKDHIVAKATREIKKRFKVLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYTHTPIMSYSTKFASNYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgcctgaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaatgagatcaactccatgcctggcgtttatcaaatgagcatggagcctctttta
aaagaatgcgaagaattagtggagcttggtataaaagccgttttattgtttggcattcct
aaacataaggacgctgcaggaagccatgcgttaaataaggatcatattgtcgcaaaagct
acgagagaaattaaaaaacgatttaaggttttgatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttgagcttgagaaaaacgctagataacgcc
ggctatacccacacgcccatcatgagctattccaccaaatttgcgagcaactactatggg
ccttttagagatgtggccaattctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagtttggaagatgaaaaacagggtgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagagattagagat
cacactttgctccctttagcgctctataacgtgagcggggaatacgccatgctcaaactc
gcgcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system