KEGG   Helicobacter pylori ELS37: HPELS_00825Help
Entry
HPELS_00825       CDS       T01798                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPELS_00825
Enzymes [BR:hpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPELS_00825
Exosome [BR:hpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPELS_00825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167384..168355)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNEINSMPGVYQMSMEPLL
KECEELVELGIKAVLLFGIPKHKDAAGSHALNKDHIVAKATREIKKRFKVLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYTHTPIMSYSTKFASNYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgcctgaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaatgagatcaactccatgcctggcgtttatcaaatgagcatggagcctctttta
aaagaatgcgaagaattagtggagcttggtataaaagccgttttattgtttggcattcct
aaacataaggacgctgcaggaagccatgcgttaaataaggatcatattgtcgcaaaagct
acgagagaaattaaaaaacgatttaaggttttgatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttgagcttgagaaaaacgctagataacgcc
ggctatacccacacgcccatcatgagctattccaccaaatttgcgagcaactactatggg
ccttttagagatgtggccaattctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagtttggaagatgaaaaacagggtgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagagattagagat
cacactttgctccctttagcgctctataacgtgagcggggaatacgccatgctcaaactc
gcgcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system