KEGG   Helicobacter pylori ELS37: HPELS_01120Help
Entry
HPELS_01120       CDS       T01798                                 

Gene name
porA
Definition
pyruvate flavodoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPELS_01120 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_01120 (porA)
   00020 Citrate cycle (TCA cycle)
    HPELS_01120 (porA)
   00620 Pyruvate metabolism
    HPELS_01120 (porA)
   00640 Propanoate metabolism
    HPELS_01120 (porA)
   00650 Butanoate metabolism
    HPELS_01120 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPELS_01120 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPELS_01120 (porA)
Enzymes [BR:hpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPELS_01120 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(222408..223631)
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGTFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcccatcaccccatcaacc
cccattgtgcaaaattatggcacctttaaggataatggctatattgatggcgagtttgtt
ttagtggaatctgagcatgccgctatgagcgcatgcgtgggagctgctgcagcaggtgga
agggtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttaaatatccatggcgatcattcggatatgtatttaagcagggattcaggctggatcagt
ttatgcacatgcaaccctcaagaagcttacgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagatgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccctttcccttatgaaagattggggcaggatttgaaaaatcttaag
gctctagcgattttagacaaaagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccctgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggtttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system