KEGG   Helicobacter pylori ELS37: HPELS_01165Help
Entry
HPELS_01165       CDS       T01798                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPELS_01165 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_01165 (glk)
   00052 Galactose metabolism
    HPELS_01165 (glk)
   00500 Starch and sucrose metabolism
    HPELS_01165 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPELS_01165 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPELS_01165 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPELS_01165 (glk)
Enzymes [BR:hpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPELS_01165 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(230898..231908)
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacgaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgcattgaagtcttgaggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccattggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaacggggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttacccggcgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttaagcggt
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aaattgagcaaggctgaattgaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggccctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttccatcccagtgcatgtcgtgctgaaaaaaactcccggactt
gatggggcgggcattgcgttagaaaattatttactgcatgatagaatttag

DBGET integrated database retrieval system