KEGG   Helicobacter pylori ELS37: HPELS_03295Help
Entry
HPELS_03295       CDS       T01798                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(671446..672714)
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQQEVKIKSLPQVVDIKAMALLLQNL
GASLEWLDPNTLQISTKSLRHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCTFLQSGGVEIEGVGSSELKIRGVENDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLDIQENSIEIYPAKQRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSIIEETLFENRFMHASELQRLGASISLKTNVATISGS
TELTGSDVMATDLRASSALVLAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVLRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaattccgcgctccccattttagccgccacgcttttaagccaacaagaagtcaaa
atcaaatctctgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgcaagcttagaatggcttgatcctaacacgcttcaaatcagcactaaatccctgcgc
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggtgttaggc
ccactattagcacgctttaaagaatgcttagtgagtttgcccggtgggtgcgctatagga
gcaaggccagtggatttacacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagccagtcttgccaaaggg
atcacgcgcatcattaacgccgctaaagagccagaaatcactcaattgtgcacgttttta
cagagtgggggggtagaaattgagggcgttggcagcagcgagttaaagattaggggggta
gaaaatgacgctttgaatttaaaagatattcaaatcataccggataggattgaagcaggc
acttatttgtgcgtgggggctatcactaacagccagcttaaaatcaatcgtatcatccct
aaccaccttcaagcgatcaccgataaactcatagaaattggtttttcactagacattcaa
gaaaattctatagaaatttacccagccaaacaacgccaagcctttgaaatcaccacgaaa
gaatacccaggctttcccacagacatgcaagcgcaattcatggcgttagccacgcagtgt
ttggggactagtatcattgaagaaacgctttttgaaaaccgcttcatgcatgcaagcgaa
ttgcaacgattgggggctagtattagccttaaaacgaatgtggctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgacggatttaagggcttcttcggctctcgtt
ttagccgctttagtggctaagggggtgagtagggtgcataggatttaccacctggatagg
ggttatgagagattagaggataaaatcaacgctttaggggcaaaagtgttgcgtttaaaa
gaaaaataa

DBGET integrated database retrieval system