KEGG   Helicobacter pylori ELS37: HPELS_04365Help
Entry
HPELS_04365       CDS       T01798                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPELS_04365
   00565 Ether lipid metabolism
    HPELS_04365
   00590 Arachidonic acid metabolism
    HPELS_04365
   00591 Linoleic acid metabolism
    HPELS_04365
   00592 alpha-Linolenic acid metabolism
    HPELS_04365
Enzymes [BR:hpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPELS_04365
    3.1.1.32  phospholipase A1
     HPELS_04365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(893532..894599)
Genome map
AA seq 355 aa AA seqDB search
MKSVLLFMNFIVCQLEGKKFLQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLAPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNNPQSAPMRMINFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGGPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYIPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgttttgctctttatgaattttatagtttgtcaattggaaggcaaaaaattt
ttgcaagataattttaaggtggattataactattatttgcgcaaacaggatttacacatc
attaagacgcaaaacgatttgtccaatgcttggtatctcgctccacaaaaagcccctaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tatttcttgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccctatcaacgcaatgagtttaaattccaaatcagctttagagtgcctgtatttagg
catattctttggactaaaggcacgctttatttggcttatacccaaactaactggtttcaa
atttacaataaccctcaatccgcccccatgcgaatgattaatttcatgcctgaactcatt
tatgtttatcctattaattttaaaccttttgggggtaaaatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggtgtggggggcgcgcaatgttaccagcctttt
aataaagaaggcaatcctgaaaaccaattcccaggagggcctgtgatcgttaaagattat
aacgggcaaaaagacgtgcgctggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtttgggaaaagggaggcttgaaaatcatggtcgcttattggccctat
atcccttatgatcaatccaaccctaatttgattgattatatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttgaacccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system