KEGG   Helicobacter pylori ELS37: HPELS_04740Help
Entry
HPELS_04740       CDS       T01798                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPELS_04740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_04740
   00620 Pyruvate metabolism
    HPELS_04740
   00640 Propanoate metabolism
    HPELS_04740
  Energy metabolism
   00680 Methane metabolism
    HPELS_04740
Enzymes [BR:hpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPELS_04740
Lipid biosynthesis proteins [BR:hpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPELS_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971444..973432
Genome map
AA seq 662 aa AA seqDB search
MQLDNDSEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKVLIVIRNAREIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLDSLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKTIAKKEPITQDLSTLEDVNVVKEIMSIAQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacaatgattcagaattcgctaaaaaaatctttaaccctaacagagcgttt
gctaagcaagccaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattacgaacatttttggggcgagttagccaagcaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttaagggatagg
atcaacgacgctcaagccaaattagttatcacagcggacgggacttttagaaaaggcaaa
ccttacatgctcaagccagcccttgacaaggctctagaaaataatgcctgccctagcgtg
gaaaaagtgctcattgtgatacgaaacgccagagagattgactatgtgagagggcgcgat
tttgtttataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctacacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcagggtatttgctgtgggcacaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacaactttgatactagaaggtacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgctaaaggcgaaaacgaacccttaaaa
tataatttagactcactcaaagttttaggaacggtgggagagcccattaaccctacagca
tggaaatggttttatgaaaaaatcggtaattcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggcc
agttgtgcgactttacctttgcctggaatccatgcagaagttttaaacgaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctatctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagcgggcataggattggcacggct
gaagtggagagtgctatttctaaacatgaaatggtggttgaatgcgcggtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcatttgtagtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgttaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttgaaaactatcgccaaaaaggagcctatcactcaa
gatttaagcacgctagaagatgtgaatgtggttaaagaaataatgagtatcgctcaaatg
gaggagtaa

DBGET integrated database retrieval system