KEGG   Helicobacter pylori ELS37: HPELS_05365Help
Entry
HPELS_05365       CDS       T01798                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01130  Biosynthesis of antibiotics
hpe01230  Biosynthesis of amino acids
Module
hpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPELS_05365
Enzymes [BR:hpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPELS_05365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFF20603
UniProt: H8H5T6
Position
complement(1098186..1098743)
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIIPQTKNCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGVPSVFDLEILGLLRRHASSLIIHQDFFISHYQLLESLVQGS
DGVVLDEELLKEDLKGMVEFSWRLGLGVFVETHKPDYTHLKDLGVLGVLEKNPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgttaggtaaaagcctgtcgtataacccttacttgcctagaatcatt
cctcaaaccaaaaattgtgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgtg
ccaagcgtgtttgatttagaaattttagggttattgcgccggcatgcgagttctttgatt
atccatcaggattttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttaaaagaggatttaaaaggcatggtagaattt
tcttggcgtttgggcttaggcgtgtttgtagagacccacaagcccgattatactcattta
aaagatttaggggttttaggcgtgctggaaaaaaacccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system