KEGG   Helicobacter pylori ELS37: HPELS_05605Help
Entry
HPELS_05605       CDS       T01798                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpe  Helicobacter pylori ELS37
Brite
Enzymes [BR:hpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPELS_05605
Secretion system [BR:hpe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPELS_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1141371..1142168)
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLIKVIEKQTNKKVRILETKPLKSNQD
LKIVVVEDPDTKYQIPLVVSKDGNLVIGLGGIFFSNKSEDVQLVAETNQKILALNTTQQN
SAKLNALFDEVPADYAIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENITKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagcgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaagacaatttgattaaagtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagactaaacccttgaaatccaatcaagat
ttaaaaatcgtggtggtagaagatccggacactaaataccaaatcccgcttgtggtgagt
aaggatggtaatttagtcatagggcttggcggtatcttttttagcaataaaagcgaagat
gtgcaattagttgcagaaaccaatcaaaaaatcctagcccttaacaccacccagcaaaat
agcgcgaagttgaacgctctttttgatgaagtgccggctgattatgcgatagagttgccc
tctactaacgctgaaaataaggacaaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaatatcacgaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcataa

DBGET integrated database retrieval system