KEGG   Helicobacter pylori ELS37: HPELS_05710Help
Entry
HPELS_05710       CDS       T01798                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00300  Lysine biosynthesis
hpe01100  Metabolic pathways
hpe01120  Microbial metabolism in diverse environments
hpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPELS_05710
Enzymes [BR:hpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPELS_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFF20666
UniProt: H8H5Z9
Position
1163175..1164341
Genome map
AA seq 388 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECRENGVKNLFLYRIFNPPKEHA
KKEHAKEKHAKENTKPLHFCFAGHIDVVPPGNNWQSDPFKPVIKEGFLYGRGAQDMKGGV
GAFLSASLQFNPKTPFLLSILLTSDEEGPGIFGTKLMLEKLKEKDLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVHLDNGDECFD
PSKLVITNLHAGLGANNVTPGSVEITFNARHSLKTTKESLKEYLEKVLKDLPYTLELESS
SSPFITASYSKLTSVLQENILKTCRTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIH
AVDERVSLKELELLEKVFLGVLEDLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaaactcatcagttaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaaccctagaatgtagg
gaaaatggcgtgaaaaacctttttttataccgcatttttaaccctcccaaagagcatgca
aaaaaagaacatgcaaaagaaaagcatgcaaaagaaaataccaaacccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctggtaataactggcaaagcgatccctttaaa
cccgttattaaagaagggtttttatacggccgtggggcgcaagacatgaaagggggcgtg
ggggcgtttttgagcgcaagcttacaatttaaccctaaaaccccttttttgctttctatt
ttactcacgagcgatgaagaagggccagggatttttggcaccaaactcatgctagaaaaa
ctcaaagaaaaggatttgctgccccatatggcgattgtggctgaacccacttgcgaaaaa
gtcttaggcgatagcatcaaaattggccgaagaggctccattaatggcaaactcatttta
aaaggcgttcaagggcatgtggcttacccgcaaaaatgccaaaaccctattgatacgctc
gcttcggttttgcccttaatttcaggagttcatttagacaatggcgatgagtgttttgac
ccttcaaaattagtcatcaccaacttgcatgcagggttaggggctaataatgttacacca
ggtagcgtagaaattacctttaatgcgcgccattctttaaaaaccaccaaagagagtttg
aaagagtatttggaaaaagttttaaaagatttgccttatactttagaattagaatcaagc
agttcgcctttcatcacggcttcttattcaaagcttaccagcgttttacaagaaaatatt
ttaaagacatgccgcaccaccccccttttaaacaccaaaggcggcacgagcgatgcgcga
ttttttagcgctcacggcatagaagtggtggaatttggcgtgattaatgataggatccat
gccgttgatgaaagggtgagcttgaaggaattagagcttttagaaaaagtgtttttgggg
gttttggaggatttaagcgaaaaataa

DBGET integrated database retrieval system