KEGG   Helicobacter pylori ELS37: HPELS_05815Help
Entry
HPELS_05815       CDS       T01798                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00010  Glycolysis / Gluconeogenesis
hpe00051  Fructose and mannose metabolism
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01120  Microbial metabolism in diverse environments
hpe01130  Biosynthesis of antibiotics
hpe01200  Carbon metabolism
hpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_05815 (tpiA)
   00051 Fructose and mannose metabolism
    HPELS_05815 (tpiA)
   00562 Inositol phosphate metabolism
    HPELS_05815 (tpiA)
Enzymes [BR:hpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPELS_05815 (tpiA)
Exosome [BR:hpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPELS_05815 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPELS_05815 (tpiA)
  Exosomal proteins of melanoma cells
   HPELS_05815 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFF20687
UniProt: H8H620
Structure
PDB: 

Jmol
Position
complement(1182269..1182973)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNAFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIIY
CIGEELTTREKSFTAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggggtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ctgaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaggaaaagtttgatttttttaaaagtaaaaattttaaaattatctat
tgtattggcgaagaattaacgaccagagaaaagagttttacggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaaacaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgattgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system