KEGG   Helicobacter pylori ELS37: HPELS_06350Help
Entry
HPELS_06350       CDS       T01798                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00860  Porphyrin and chlorophyll metabolism
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPELS_06350 (hemD)
Enzymes [BR:hpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPELS_06350 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFF20790
UniProt: H8H6D8
Position
1296175..1296855
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNELCYYPLELDPTPFNALVFTSKNAVFSLLKTLNNSPKLK
TLQNIPAYALSEPTAKTLQDHHFKTAFIGKKAHGKEFAKEILPLLKGKSVLYLRAKEIAS
PLDAILLEHGINLKQAVVYENKLKHLTLSEQNALKPQEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTASYLKEKGIQSYIAQKPSLEACLELALNLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattatgctactatcccttagaattagatccaaccccttttaacgcccttgttttc
acttctaaaaatgcggtgttttccttgctaaaaaccctaaacaacagccccaaactcaaa
acgttacaaaacattcctgcttacgctttgagtgaacccaccgcaaaaactctacaagat
caccattttaaaactgcctttatagggaaaaaagcccatggtaaagagttcgccaaagaa
atccttcctttattgaaaggaaaaagcgttttgtatctcagggcaaaagaaattgcctct
cctttagacgccattcttttagaacatggcattaatcttaaacaagccgttgtttatgaa
aacaagctcaaacatttgactttaagcgaacaaaacgccttaaaaccccaagaaaagagc
gttctcattttcaccgccataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctatcagcattggcaacacgaccgcttcttatttaaaagagaaaggc
attcaaagctatatagctcaaaagccctccttagaagcgtgtttagaactggctttaaat
ttgagggttaaggaatgttaa

DBGET integrated database retrieval system