KEGG   Helicobacter pylori ELS37: HPELS_06390Help
Entry
HPELS_06390       CDS       T01798                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301818..1302960
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEKIAQNHMHQKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFSSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKTEQDR
LKEVLLEIKSQKLYQCAQFSIDTYHATTAQMALEHCFSILNDVSGFNSIEMLEVARDYKP
TCVLMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGRGVQDRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEEAD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaaacgctctgcaaaaaataggccca
gaaaagatcgcacaaaaccatatgcaccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccctaagcgcaacgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctgatt
gcgagcgctaagcaattagaacgcctgattgttaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccacctcaaagctaaaaagcctaacgccccacag
atcatggcaatcttgaatctcacgccggatagtttctatgaaaagagccgttttagtagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggtgcggccagttcaagaccgcagagtgaaatcattgatccaaaaacagagcaagatcgc
ttgaaagaagttttattagagatcaaatcccaaaaactctaccaatgtgctcaattcagc
atagacacctaccatgccacaacggcccaaatggctttggagcattgtttttctatcctt
aatgacgtgagcggttttaatagtattgaaatgctagaagtcgcacgagattacaagccc
acttgcgttttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgtcttttac
cacaatctgtttgatgaaatggatcgcttttttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcacttaagccactttctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtggagttcaagaccggctc
gctggcactttgagtttgcatttaatggcgctgcaaaacggagcgagtattttaagagtg
catgatattgatgagcatatagatttaattaaagtgtttaagagtttggaagaagcggat
taa

DBGET integrated database retrieval system