KEGG   Helicobacter pylori ELS37: HPELS_06635Help
Entry
HPELS_06635       CDS       T01798                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00260  Glycine, serine and threonine metabolism
hpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01130  Biosynthesis of antibiotics
hpe01230  Biosynthesis of amino acids
Module
hpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPELS_06635 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPELS_06635 (trpA)
Enzymes [BR:hpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPELS_06635 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: AFF20847
UniProt: H8H6J5
Position
complement(1348734..1349522)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKHEKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDGFYAQAKECG
IDSVLIADMPLIEKELVLKSAQKHHIKQIFIASPNASVKDLEQAATHSQGYIYTLARSGV
TGISHALENDASAIIKTLKAFSPTPALLGFGISQKEHITNAKEMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacacgaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gatagcggggtgagtgctttggaattgggctttgctttctcagatcctgtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaggctacaaccatgatattcccatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaagctaaagaatgcggt
atagatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaagcaccacattaaacaaatctttatcgccagccctaatgcgagcgttaaagat
ttagaacaagccgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acagggataagccatgctctagagaacgatgcaagcgcgatcatcaaaaccttaaaagcc
tttagccccacccccgccttattgggctttggcatttctcaaaaagaacacatcacaaac
gctaaagaaatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system