KEGG   Helicobacter pylori ELS37: HPELS_06640Help
Entry
HPELS_06640       CDS       T01798                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00260  Glycine, serine and threonine metabolism
hpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01130  Biosynthesis of antibiotics
hpe01230  Biosynthesis of amino acids
Module
hpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPELS_06640
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPELS_06640
Enzymes [BR:hpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPELS_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFF20848
UniProt: H8H6J6
Position
complement(1349524..1350699)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLDLKCVIFMGEKDIKRQEMNVFRMRLLGTEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKESKRAVYESASDTEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCAQESIIVVNLSGRGDKDLSTVYNALKEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagagtattttcgtctcttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaacatcgtttctaaccctaaagttaagctttatttaaaacgagaggatttaatccat
ggcggggcgcataagactaatcaggccttagggcaagctcttttagcgaaaaaaatgggg
aagacaaggatcattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgtgcgttattggacttaaaatgcgtgatttttatgggagaaaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattgggcactgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggctttaagagattgggcgagcagctataag
gacacgcattatttgctaggcacagccgctgggccacacccttaccctacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaagtgaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaagggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagcgcc
gggcttgattatccaggggtggggccagaacacagctatttgaaagagagtaagcgcgcg
gtttatgaaagtgcaagcgatactgaagcgctagaggccttcagtttgttgtgtcaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgcacaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaggaggtttaa

DBGET integrated database retrieval system