KEGG   Helicobacter pylori ELS37: HPELS_06640Help
Entry
HPELS_06640       CDS       T01798                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPELS_06640
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPELS_06640
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPELS_06640
Enzymes [BR:hpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPELS_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1349524..1350699)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLDLKCVIFMGEKDIKRQEMNVFRMRLLGTEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKESKRAVYESASDTEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCAQESIIVVNLSGRGDKDLSTVYNALKEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagagtattttcgtctcttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaacatcgtttctaaccctaaagttaagctttatttaaaacgagaggatttaatccat
ggcggggcgcataagactaatcaggccttagggcaagctcttttagcgaaaaaaatgggg
aagacaaggatcattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgtgcgttattggacttaaaatgcgtgatttttatgggagaaaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattgggcactgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggctttaagagattgggcgagcagctataag
gacacgcattatttgctaggcacagccgctgggccacacccttaccctacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaagtgaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaagggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagcgcc
gggcttgattatccaggggtggggccagaacacagctatttgaaagagagtaagcgcgcg
gtttatgaaagtgcaagcgatactgaagcgctagaggccttcagtttgttgtgtcaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgcacaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaggaggtttaa

DBGET integrated database retrieval system