KEGG   Helicobacter pylori ELS37: HPELS_06645Help
Entry
HPELS_06645       CDS       T01798                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01130  Biosynthesis of antibiotics
hpe01230  Biosynthesis of amino acids
Module
hpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPELS_06645
Enzymes [BR:hpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPELS_06645
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPELS_06645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI CdhD
Motif
Other DBs
NCBI-ProteinID: AFF20849
UniProt: H8H6J7
Position
complement(1350700..1352058)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSALKENHTLPANITPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKHFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARVMGADAVLLMLSALDDKNYLELFNLAKSLNMSVLTEVSNKQEIERLLKLQYDIIGI
NNRDLHTLTTDINNTLKLRSLLPKDALVVSESGIYLHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKKALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVISVMN
AKDLVPRIQEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcttagaagtctctgcacttaaa
gaaaatcacaccttgcccgcaaacataaccccaagcgatagggattttaaaaaagcgtta
ttagaaaaaaagacaagttttattttagaatgcaaaaaagcatcgccctctaaaggttta
ataagaaaagattttgatctgttaaaaatagccaagacttatgaaaaatttgcctcttgt
atttcagttttagccgattctaaacattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttatgcaaagattttatcattgacgcttttcagatc
aaactcgctagggttatgggagctgatgcggtgcttttaatgctgagcgcgttagatgat
aaaaactatttagagctctttaacctcgccaaatccttaaacatgagcgtgttaactgaa
gtctccaataagcaagaaattgagcgcttgctcaaactccaatacgacattataggcatc
aataacagggatttgcacaccctaacaaccgacattaacaacacgctcaaattacgctct
ctcttgcctaaagacgcgctcgtggtgagtgagtccggtatttatttgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaaa
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaaaaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtaaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattctcaaaaagaaatcgct
caattgaaaaaatcgctccctaaaacttgcgcgatctggcaagtaataagcgtgatgaac
gctaaagatttagtgcctagaattcaagaggcctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgctagctggggggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattccggtttagaaataagccctgggattaaaaataaggat
aaaatcaagcgcttagcccgaattttaagagagtattaa

DBGET integrated database retrieval system