KEGG   Helicobacter pylori F30: HPF30_0119Help
Entry
HPF30_0119        CDS       T01895                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00260  Glycine, serine and threonine metabolism
hpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpf01100  Metabolic pathways
hpf01110  Biosynthesis of secondary metabolites
hpf01130  Biosynthesis of antibiotics
hpf01230  Biosynthesis of amino acids
Module
hpf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF30_0119 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF30_0119 (trpB)
Enzymes [BR:hpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF30_0119 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAJ56216
UniProt: E6NHG3
Position
107563..108744
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVVFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEIKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESGRAIYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIVVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgagaaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcataagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtggtttttatgggggctaaagacatcaaacgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtcagagaggttaattcagga
agcgcgacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccctacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagc
gcgtttttaaacgacaaagagattaaactcataggcgtagagccagcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagaaagcgggcgcgcg
atttatgaaagcgcaagcgatcttgaagcactagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgccttagcgtatgccttaaaactcgct
caaaaatgcgaagaagaaagcatcgttgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system