KEGG   Helicobacter pylori F30: HPF30_0120Help
Entry
HPF30_0120        CDS       T01895                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpf  Helicobacter pylori F30
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF30_0120 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF30_0120 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF30_0120 (trpA)
Enzymes [BR:hpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF30_0120 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
108741..109529
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIIKTLITSGVSALELGFAFSDPVADG
VTIQASHLRALKHATMGKNFQLLKEIRSYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASDKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgcattgagttttgaaatcattaaaaccttaatc
actagtggggtgagcgctttagaattggggtttgctttttcagatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaagcatgctactatgggaaaaaatttc
cagcttttaaaagagattagaagttacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagtcccaatgcgagtgataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagccccacaccggccttattaggctttggcatttctaaaaaagaacacataaaaaac
gctaaaaacatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system