KEGG   Helicobacter pylori F30: HPF30_0164Help
Entry
HPF30_0164        CDS       T01895                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpf  Helicobacter pylori F30
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154799..155941)
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKSAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKKPFYDGVLIVSASQLERLIVKCHSQPFGLKNLVQELKSHLKAQKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEILLEIKSQKLYQYAQFSIDTYHATTAQMALEHYFSILNDVSGFSSIKMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLIALQNGASILRA
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcgctcaaaaacgcccttttaaaaaccggatca
gaaaaatccgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccag
catctgcccttaagcgccacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaaaagcctttttatgatggggtgttgatt
gtgagcgctagccagttagaacgccttattgtcaagtgccattcccaaccctttgggctt
aaaaatttagtgcaagaattaaaaagccaccttaaagcccaaaagcctaacaacccgcag
atcatggcaatcttgaatctcacgccggatagcttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcggcaagttcaaggccacagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagagatcaaatcccaaaaactctaccaatacgctcaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagtggttttagtagtattaaaatgctagaagtcgccagagattacaagccc
acttgcattttaatgcacgctcaaaagacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaagaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttaagcctgcatttaatagcgctgcaaaatggagcgagcattttaagagcg
catgacattgatgagcatatagacctcatcaaggtgtttaagagtttagaagaaacagat
tga

DBGET integrated database retrieval system