KEGG   Helicobacter pylori F30: HPF30_0277Help
Entry
HPF30_0277        CDS       T01895                                 

Gene name
porB
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00010  Glycolysis / Gluconeogenesis
hpf00020  Citrate cycle (TCA cycle)
hpf00620  Pyruvate metabolism
hpf00640  Propanoate metabolism
hpf00650  Butanoate metabolism
hpf00680  Methane metabolism
hpf01100  Metabolic pathways
hpf01120  Microbial metabolism in diverse environments
hpf01130  Biosynthesis of antibiotics
hpf01200  Carbon metabolism
Module
hpf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF30_0277 (porB)
   00020 Citrate cycle (TCA cycle)
    HPF30_0277 (porB)
   00620 Pyruvate metabolism
    HPF30_0277 (porB)
   00640 Propanoate metabolism
    HPF30_0277 (porB)
   00650 Butanoate metabolism
    HPF30_0277 (porB)
  Energy metabolism
   00680 Methane metabolism
    HPF30_0277 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF30_0277 (porB)
Enzymes [BR:hpf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF30_0277 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: BAJ56374
UniProt: E6NHX1
Position
complement(283879..284823)
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKDRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagtgctgaaaaattccaaggc
tcgcacttgctttgtccgggttgcgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgctagtgaataaggaccgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctggataatgaa
aactacgccaacaccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggcaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaggctaaagtataa

DBGET integrated database retrieval system