KEGG   Helicobacter pylori F30: HPF30_0416Help
Entry
HPF30_0416        CDS       T01895                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpf  Helicobacter pylori F30
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPF30_0416 (recR)
DNA repair and recombination proteins [BR:hpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPF30_0416 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(434963..435544)
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALRITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgcttaggatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgtgcatcttgtaacgcactcagtgagagtgaggtttgtgagatttgctctgatgagagc
agacaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggattttttagggcgctattatgtgttaaactctatagaagaagtggattttaac
gccctagaaaaacgcttgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattacagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggattaaagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system