KEGG   Helicobacter pylori F30: HPF30_0452Help
Entry
HPF30_0452        CDS       T01895                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpf  Helicobacter pylori F30
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489531..490082
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEAHIEVRGVVYEVQVSMRTSALLQAGQEARLKILQVIKEDVHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVQGIGKKLA
DKIMVDLIGFFIQDETSPVRNEVFLALESLGFKSAEINKVLKTLKPHLSTEAAIKEALQQ
LHS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatttctgctttagaagcacatatagaa
gtgcgaggggttgtttatgaggtgcaagtttctatgcgaacttctgctttgcttcaagcg
ggccaagaagcgcgtttgaaaatcttacaagtgattaaagaagatgtgcatcttttatac
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcgccgaatgaatttgaaaacatt
atcgccactaaagaagtcaaaagactccagcaagtccaaggcataggcaaaaagctcgct
gataagatcatggtggatttgattggttttttcattcaagatgaaactagccctgtgcgc
aatgaagtctttttagccctggagagtttgggctttaaaagcgctgaaatcaataaagtt
ttaaaaaccctaaaaccccatctcagcaccgaagcagcgattaaagaagccttacaacaa
ctgcactcttaa

DBGET integrated database retrieval system