KEGG   Helicobacter pylori F30: HPF30_0886Help
Entry
HPF30_0886        CDS       T01895                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpf  Helicobacter pylori F30
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(957130..957618)
Genome map
AA seq 162 aa AA seqDB search
MREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSPV
YINPPFGYTNQPNFYNATIILKTSLSLRHFFALVFYVERRFGRQRKRDFKDAPRTLDIDI
IAFNQVILRQNDLTLPHPKWNERDSVLVPLALQQILFKKGEW
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgatttt
tctaacagggtggttttagggctgggatctaatcttaaaaatcctttaaaaatattaaaa
aattgttttttatactttaaaaatcatagtaaaatcgggaaaattttttcttcgcctgtt
tatatcaacccgccttttggttacactaatcaacctaacttttataatgctacgattatc
cttaaaacatctttaagtttgcgccattttttcgctctggttttttatgtagaaaggcgt
tttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgatatt
atcgctttcaatcaagtcattttaagacagaatgatttgactttacctcatcctaaatgg
aatgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaaggg
gagtggtga

DBGET integrated database retrieval system