KEGG   Helicobacter pylori F30: HPF30_0895Help
Entry
HPF30_0895        CDS       T01895                                 

Gene name
acoE
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpf  Helicobacter pylori F30
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hpf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966991..968979
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRIIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDTQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGHD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IKDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLDSLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGTKTKSGEQGFLCITKPWPSMI
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVAECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSIE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagatgatgatttagaattcgctaaaaaaatctttaaccctaacagagcgttt
gctaagcaagccagaattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaaacaaaaactcacatggtttaagccc
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
atcattatctacatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagagatagg
atcaacgacactcaagccaaattagttatcacagcagatgggactttcagaaaaggcaaa
ccctacatgctcaagccagcccttgacaaggctctagaaaataacgcctgccctagtgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcacgat
tttgtctataatgaaatggttaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcagggtatttgttgtgggcgcaaatgacgatggaatgggtttttgat
attaaagataatgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacgactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgagtggataaattc
tacacttcccccaccgctataagaatgctgcatgccaaaggcgaaaacgaacccttaaag
tataatttagactcactcaaagttttagggacggtgggagagcccattaatcctacggca
tggaaatggttttatgaaaaaatcggtaattcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggct
agttgtgcgaccttacctttgcctggcatccatgcagaagttttaaacgaagacggcact
aaaacaaagtccggagagcaagggtttttatgcatcactaagccatggccttctatgata
agaaacatttggggcgatgaaaaacgatacattgacagctatttttctcaaatcaagttg
aatggggagtatgtctacctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagcgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggctgaatgcgcggtagtgggtatc
cctgacacgattaaaggagagggcttatttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgctaaaagaaatgaatcatatcttatccattgag
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agtgggaaaatcatgagaagacttttgaaatctatcgctaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaataatgagtatcgttcaaatg
gaagagtga

DBGET integrated database retrieval system