KEGG   Helicobacter pylori F30: HPF30_1100Help
Entry
HPF30_1100        CDS       T01895                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00010  Glycolysis / Gluconeogenesis
hpf00051  Fructose and mannose metabolism
hpf01100  Metabolic pathways
hpf01110  Biosynthesis of secondary metabolites
hpf01120  Microbial metabolism in diverse environments
hpf01130  Biosynthesis of antibiotics
hpf01200  Carbon metabolism
hpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF30_1100 (tpiA)
   00051 Fructose and mannose metabolism
    HPF30_1100 (tpiA)
   00562 Inositol phosphate metabolism
    HPF30_1100 (tpiA)
Enzymes [BR:hpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPF30_1100 (tpiA)
Exosome [BR:hpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPF30_1100 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPF30_1100 (tpiA)
  Exosomal proteins of melanoma cells
   HPF30_1100 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAJ57197
UniProt: E6NK94
Position
complement(1173185..1173889)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPHHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSQHLEELKINTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEALTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQVLNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcaccattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctgaaaatcaacacgcttttaatagggcatagcgagaggcgagcacttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttctttaaaagtaaaaattttaaaattgtttat
tgtattggcgaagcattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aatgagcaattagaaaatattgatcttaattatcctaatttagtggtagcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttacctcacgcatggt
tttttaaagcaagttttaaatcaaaaaacgcccttgttgtatggggggagcgtgaacacg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagtgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system