KEGG   Helicobacter pylori F30: HPF30_1100Help
Entry
HPF30_1100        CDS       T01895                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpf  Helicobacter pylori F30
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hpf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpf01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpf00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpf00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1173185..1173889)
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLEELEKTLKPHHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSQHLEELKINTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEALTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQVLNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcaccattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctgaaaatcaacacgcttttaatagggcatagcgagaggcgagcacttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttctttaaaagtaaaaattttaaaattgtttat
tgtattggcgaagcattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aatgagcaattagaaaatattgatcttaattatcctaatttagtggtagcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagatatttacctcacgcatggt
tttttaaagcaagttttaaatcaaaaaacgcccttgttgtatggggggagcgtgaacacg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagtgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system