KEGG   Helicobacter pylori F30: HPF30_1191Help
Entry
HPF30_1191        CDS       T01895                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpf  Helicobacter pylori F30
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263800..1264438
Genome map
AA seq 212 aa AA seqDB search
MPNMNTHTRGIDSGLIYSLQSISLSMFRKGFFGLYQGSISARIDTNQFVINKRNAIFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHDRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacatgaacacacacacaagaggcattgacagtgggctgatttattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattgacacgaatcaatttgtgatcaataaaagaaacgctatttttgatcaattg
aatgaaaacaccttgttggttttgcatgataagattgattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccacgaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttaatg
gattattgttataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system