KEGG   Helicobacter pylori F30: HPF30_1310Help
Entry
HPF30_1310        CDS       T01895                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpf  Helicobacter pylori F30
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391721..1392524
Genome map
AA seq 267 aa AA seqDB search
MHAFEIYPKVNIFLKILHKEGAYHKLISRMCLVKDKFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYRMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPKTCFSQAKEWLKKPSLECLKTYDRNELNDLLKPALLTNQALRDIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgagatttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttagtcaaagataaattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcactaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
cagatttttgattggcgtttgagtttagaagagctttatcgcatgggatctttagtgggc
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgccaaac
catgttttttgcagcaccaaagccatttatcaagcctataaacctaaaacttgtttttct
caagctaaagagtggcttaaaaaaccgagtttagaatgcctaaagacttatgatagaaac
gaattaaacgatcttttaaaaccagccttactcactaaccaagccttgagagatatagaa
agcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system