KEGG   Helicobacter pylori F30: HPF30_1411Help
Entry
HPF30_1411        CDS       T01895                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpf  Helicobacter pylori F30
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF30_1411 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPF30_1411 (rocF)
Enzymes [BR:hpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPF30_1411 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503947..1504915)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDKLRAVEVTEYNPTVSAKHTDEEEKQVLE
ILDLIINSCKIKDKKPSFTMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagttttgagtgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcattcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgccaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcacatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagagaaggcatggcaa
aaactctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagttgaag
caattactgggcttgcttttagaaagctttaaagacaaattaagagccgttgaggtaacc
gaatacaaccccacggtgagcgcaaaacacaccgacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagacaagaagccatcttttacaatg
agtcgttga

DBGET integrated database retrieval system