KEGG   Helicobacter pylori G27: HPG27_1031Help
Entry
HPG27_1031        CDS       T00777                                 

Definition
spore coat polysaccharide biosynthesis protein C
Orthology
K15895  
UDP-4-amino-4,6-dideoxy-L-N-acetyl-beta-L-altrosamine transaminase [EC:2.6.1.92]
Organism
hpg  Helicobacter pylori G27
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134471..1135598
Genome map
AA seq 375 aa AA seqDB search
MKEFAYSEPCLDEEDKKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSAL
LTLYRNFSEFSADCNEIITTPISFVATANMLLESGYRPVFAEVKNDGNIDELALEKLITK
KTKAIVSVDYAGKSVEIGSIQKLCKKHSLSFLSDSSHALGSEYQNKKVGGFALASVFSFH
AIKPITTAEGGAVVTNDSELYEKMKLFRSHGMLKKDFFEGEVKSIGHNFRLNEIQSALGL
SQLKKAPLLMQKREEAALTYDRIFKDNPYFTPLHPLLKYKSSNHLYPILMRQKFFTCKKL
ILENLHKRGILVQVHYKPIYQYQLYQQLFNTAPLKSAEDFYRAEISLPCHANLNLESVQN
IAHGVLKTFEDLKIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagtttgcttatagcgagccttgtttagatgaagaagataaaaaggctgtttta
gaggttttaaattccaaacagctcacgcaaggcaaacgctctctgttatttgaagaagct
ttgtgcgaatttttgggcgttaaacatgcgttagtgtttaacagcgcgacttcagccctt
ttaacgctctataggaattttagcgaatttagtgctgattgtaatgaaataatcaccacc
cctataagctttgtagcgacggctaacatgctcttagagagtggttatagacccgtgttt
gctgaagtcaaaaacgatggcaatatagatgaattggccctagaaaagctcattactaaa
aaaaccaaagccatagtgagcgtggattatgccggtaaaagcgtagaaataggaagcatt
caaaagctttgcaaaaaacattctttgagttttctttctgacagctcgcatgctctagga
agcgagtatcaaaacaaaaaagtaggaggctttgcgttagcgagcgtgtttagtttccat
gccattaagcctatcactacggccgaagggggagcggtcgttactaacgatagcgaattg
tatgaaaaaatgaaattgtttcgctctcatggcatgctcaaaaaagatttttttgaaggc
gaagtcaaaagcatagggcataacttccgcttgaatgaaatccaaagcgctttgggtttg
agccagcttaaaaaagccccccttttaatgcaaaaaagagaagaagccgctctaacctat
gacaggatttttaaagataacccttatttcacccctttacaccccttgttaaaatataaa
agctctaaccacctttatcctattttaatgcgccaaaaattttttacatgcaaaaaactt
attttagaaaatttgcacaagcgtggcattttagtccaagtgcattacaagcccatttac
caataccaattgtatcaacagctctttaacacagccccattaaaaagtgcggaggatttt
tatcgcgctgaaatttctttgccttgtcatgcgaatttgaatttagagagcgttcaaaac
atcgctcatggcgttttaaaaacttttgaggatcttaagatagaatga

DBGET integrated database retrieval system