KEGG   Helicobacter pylori G27: HPG27_104Help
Entry
HPG27_104         CDS       T00777                                 

Definition
(GenBank) L-fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00051  Fructose and mannose metabolism
hpg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPG27_104
Enzymes [BR:hpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPG27_104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACI26873
UniProt: B5Z9P3
Position
119330..119893
Genome map
AA seq 187 aa AA seqDB search
MFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASQDSPI
HASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQE
RADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYN
DDPRLSV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaagggtttttttgggctttatcaaggctctatttcagcacgcattggcacc
aatcaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaacacctta
ctggttttgcatgacaagatagattaccgctggaaagaggcgagccaggattcgcccatt
catgcgagcgtgtatagggagtttttggacgctaaattcatcgcttacgcacgccctcct
tatagtttggcgtattccttgcgccacaaccgattgctccctagggattatttagggtat
cgttctttgggcgaagaaatttccatttttaaccccaaagattatgacagctggcaagaa
agagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgttttcatt
aaggggtgtgggatttttgcctaccacagagagctttctaaactcatggaagtttttgat
ttgattgaaaactcatgcaaggttttacgattgggcgatttaatggattattgctataat
gatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system