KEGG   Helicobacter pylori G27: HPG27_1044Help
Entry
HPG27_1044        CDS       T00777                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpg  Helicobacter pylori G27
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPG27_1044 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPG27_1044 (glk)
   00052 Galactose metabolism
    HPG27_1044 (glk)
   00500 Starch and sucrose metabolism
    HPG27_1044 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPG27_1044 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPG27_1044 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPG27_1044 (glk)
Enzymes [BR:hpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPG27_1044 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1149104..1150048
Genome map
AA seq 314 aa AA seqDB search
MEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLKLHPIYGSFAVATPIMGDFVQMT
NNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQENDLAQIGGIKCEINAPKAILGP
GTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEILVWQYARSKFNHVSAERFLSGSG
LVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGDYPICRLTLDTFCSMLGTLAADV
ALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGRMGAFLASIPVHVVMKKTPGLDG
AGIALENYLLHDKI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtcgccccacgacagattgaatgcattgaagtcttgcggtgcgaagattttgag
agcttgagcgatgcggtgcgattttatctttctaaatgcaaagaaagccttaaactgcac
cctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaaatgact
aacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaaaaattg
cttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaaaacgat
ctggctcaaataggcgggattaagtgtgaaatcaacgctcctaaagcgattttagggcca
ggaactgggcttggggtaagcactcttatccaaaatagcgatggctctttaaaagtcttg
cccggtgaaggagggcatgtgagctttgccccttttgatgatctagaaattttagtgtgg
caatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggtagcggt
ttggtgttgatttatgaagccctgtccaaacgcaaaggcttagaaaaagtggcgaagttg
agcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggattaccct
atatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgctgatgtg
gctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccacgattc
attgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgcatggga
gcgtttctcgcttctatccctgtgcatgtcgtgatgaaaaaaactcccggacttgatggg
gcaggcattgcgttagagaattatttactgcatgataaaatttag

DBGET integrated database retrieval system