KEGG   Helicobacter pylori G27: HPG27_1050Help
Entry
HPG27_1050        CDS       T00777                                 

Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hpg  Helicobacter pylori G27
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPG27_1050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPG27_1050
   00020 Citrate cycle (TCA cycle)
    HPG27_1050
   00620 Pyruvate metabolism
    HPG27_1050
   00640 Propanoate metabolism
    HPG27_1050
   00650 Butanoate metabolism
    HPG27_1050
  Energy metabolism
   00680 Methane metabolism
    HPG27_1050
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPG27_1050
Enzymes [BR:hpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPG27_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155029..1155589
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagctggccaaggcgctatcaccggtgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcgttgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatcccggtttggttttcatt
gaaaatattttcgctaatgaaaaagaagacacgacctatatcatcactagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccctatccctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system