KEGG   Helicobacter pylori G27: HPG27_1053Help
Entry
HPG27_1053        CDS       T00777                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00010  Glycolysis / Gluconeogenesis
hpg00020  Citrate cycle (TCA cycle)
hpg00620  Pyruvate metabolism
hpg00640  Propanoate metabolism
hpg00650  Butanoate metabolism
hpg00680  Methane metabolism
hpg01100  Metabolic pathways
hpg01120  Microbial metabolism in diverse environments
hpg01130  Biosynthesis of antibiotics
hpg01200  Carbon metabolism
Module
hpg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPG27_1053
   00020 Citrate cycle (TCA cycle)
    HPG27_1053
   00620 Pyruvate metabolism
    HPG27_1053
   00640 Propanoate metabolism
    HPG27_1053
   00650 Butanoate metabolism
    HPG27_1053
  Energy metabolism
   00680 Methane metabolism
    HPG27_1053
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPG27_1053
Enzymes [BR:hpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPG27_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ACI27806
UniProt: B5Z8A7
Position
1157244..1158188
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALTNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWRFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
DRWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaatttcaaggc
tcgcacttgctttgcccgggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaggcgatgtataaagcgcttacgaataagggtcgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggctagttatgatattggccttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccagcgggatcggtgagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggtcccttatgtggcacagctctcgcctaacaaatggaaagac
atgaataaaaagattaaaaccgcgctagacactgaagggccttgctttatcaacgctctt
agcccatgcacgactgaatggagatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccttatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaaacgcttc
aaacaccttttcaaaaaggaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gatcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system