KEGG   Helicobacter pylori G27: HPG27_1168Help
Entry
HPG27_1168        CDS       T00777                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpg  Helicobacter pylori G27
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPG27_1168 (hemD)
Enzymes [BR:hpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPG27_1168 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288454..1289134
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNELHYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
MLQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEESVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIPSYIAQKPSLEACLELALSLRVKER
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagagagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aacgaattgcactactatcccttagaattagatccaaccccttttaacgcccttattttc
acctctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactcaaa
atgttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatcttagggcaaaagaaattgcctct
tctttagacaccattcttttagagcatggcattgatttcaaacaagccgttgtttatgaa
aacaagctcaaacatttgaccttaagcgaacaaaacgccctaaaacccaaagaagagagc
gttcttatttttaccgctataagccacgcaaaagcctttttgcactattttgaattttta
gaaaattataccgctatcagcattggcaacacgaccgctctttatttacaagaacaaggc
attccaagctatattgcccaaaagccctccttagaagcgtgtttagaactggctttaagt
ttgagagttaaggaacgttaa

DBGET integrated database retrieval system