KEGG   Helicobacter pylori G27: HPG27_1176Help
Entry
HPG27_1176        CDS       T00777                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpg  Helicobacter pylori G27
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294080..1295222
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPNALKNALQKIGPEKIAQDRMRQKGVSFVFEIQHLPLSAVLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFSSKKALEEIYQWLEKGITLIDIGAASSRPESEIIDPKIEQDR
LKEILLEIKSQKLYQCAQFSIDTYHATTAQMALEHCFSILNDVSGFNSAEMLEVARDYKP
TCILMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASVLRV
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctaatgcgctcaaaaacgctttacaaaaaataggccca
gaaaagatcgcgcaagatcgtatgcgccaaaaaggcgttagctttgtttttgaaatccag
catctgcccttaagcgctgtgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagccaaagagcctttttatgatggggtgttgatt
gcgagcgctaagcaattagaacgccttattgttaagtgccactcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccatctcaaagctaaaaaacctaacgccccacaa
atcatggcaatcttaaatctcacgccggatagtttctatgaaaagagccgttttagtagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggtgcggccagttcaaggccagagagtgaaattattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgctcaattcagc
atagacacctaccatgccacaacggcccaaatggctttggaacattgtttttccatcctt
aatgatgtgagcggtttcaatagcgctgaaatgctagaagtcgcaagagattacaagccc
acttgcattttaatgcatactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcacttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccctattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttgagtttgcatttaatggcgttgcaaaacggagcgagtgttttaagagtg
catgacattgatgagcatatagacctcatcaaggtgtttaagagtttagaagaaacggat
taa

DBGET integrated database retrieval system