KEGG   Helicobacter pylori G27: HPG27_1220Help
Entry
HPG27_1220        CDS       T00777                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpg  Helicobacter pylori G27
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPG27_1220
   00030 Pentose phosphate pathway
    HPG27_1220
   00051 Fructose and mannose metabolism
    HPG27_1220
   00052 Galactose metabolism
    HPG27_1220
   00500 Starch and sucrose metabolism
    HPG27_1220
   00520 Amino sugar and nucleotide sugar metabolism
    HPG27_1220
  Nucleotide metabolism
   00230 Purine metabolism
    HPG27_1220
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPG27_1220
Enzymes [BR:hpg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPG27_1220
    5.4.2.8  phosphomannomutase
     HPG27_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1338443..1339822
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMRKYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVSYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLSTKHEIKPLKEIPEKVNALEAYQRYLIKDFKHLRNLKYKIALDFGN
GVGALGLEPILKALNIDFNSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEVLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgaaaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcagggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
tcgtattttgcagcctttaatgaaatcaatggtattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttacggcaaggatattcaagctttaaaagacacgcttttaagcacaaagcatgaaata
aaacccttaaaagaaataccagagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggactttaaacatttaagaaatcttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttaacagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttggcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgataggc
gaagtcaaatgttctcaagtgatgtataacacgatcaatacttttggcaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgctcgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagtgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaataatcagcattgatggcgtaagagtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagggcgttgctcaatttattagaaaaactttaa

DBGET integrated database retrieval system