KEGG   Helicobacter pylori G27: HPG27_1224Help
Entry
HPG27_1224        CDS       T00777                                 

Definition
(GenBank) tryptophansynthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpg  Helicobacter pylori G27
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPG27_1224
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPG27_1224
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPG27_1224
Enzymes [BR:hpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPG27_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1341850..1343031)
Genome map
AA seq 393 aa AA seqDB search
MNQKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVIFMGGKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKEIGRAVYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttaaaagatgaaaaattccaa
aaagagtattttcgtcttttaaaggattttgtgggccgtcctagccctttaaccttgtgt
caaaacatcgtttctaaccctaaagtcaagctttatttaaaacgagaggatttaatccat
ggcggggcgcataagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggg
aaaacaaggattatcgctgaaacaggcgctgggcagcatggcgtggcgacggctatcgct
tgtgcgttattgaatttaaagtgcgtgatttttatgggaggcaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattaggtgctgaagtgagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccgcacccttaccctacaatggtcaaa
acatttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatattcagt
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagattgggcgtgcg
gtttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccggcattagagagttcgcatgcattagcgtatgccttaaagctcgct
caaaaatgcgaagaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system