KEGG   Helicobacter pylori G27: HPG27_1225Help
Entry
HPG27_1225        CDS       T00777                                 

Definition
(GenBank) N-(5'-phospho-ribosyl) anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpg01100  Metabolic pathways
hpg01110  Biosynthesis of secondary metabolites
hpg01130  Biosynthesis of antibiotics
hpg01230  Biosynthesis of amino acids
Module
hpg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPG27_1225
Enzymes [BR:hpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPG27_1225
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPG27_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACI27973
UniProt: B5Z8S4
Position
complement(1343033..1344382)
Genome map
AA seq 449 aa AA seqDB search
MLENILKDKLLEVSALKKNHTLPVNINPSDRDFKKALLEKKTSFILECKKASPSKGLIRK
DFDLLKITKTYEKFASCVSVLADSKYFLGSYKNIKIVSQHSTKPILCKDFIIDAFQIKLA
RMMGANAVLLMLSVLDDKSYLELFNLAKSLNMSVLTEVSNKQEIEHLLKLQYDIIGINNR
DLHTLKTDINHTLELRPLLPKDALIISESGIYSHAQIKALAPYVNGFLVGSSLMKEKDLK
KACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKL
DFVGMFVKDKIKKIQKIAKKLDLKAVQLYGYSPKKIAQLKKVLPKTCAIWQVISVMNAKD
LAPKIKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVEALG
LDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaaacatccttaaagacaaactcctagaagtctctgcgctcaaaaaaaatcac
accttaccggtaaacataaacccaagcgatagggattttaaaaaggcgttactagaaaaa
aaaaccagctttattttagaatgcaaaaaagcatcgccctctaaaggtttgatcagaaaa
gattttgacttgttgaaaataacgaaaacttatgaaaaattcgcctcttgtgtttcagtt
ttggccgattctaaatattttttaggctcttataaaaacattaaaattgtctcgcagcat
tccaccaagcccattttgtgtaaagattttatcattgacgcttttcaaatcaaactcgct
agaatgatgggggctaatgcggtgcttttaatgttaagcgtgttagatgataaaagttat
ttagagcttttcaacctcgccaaatccttaaacatgagcgtgttaactgaagtttccaac
aagcaagaaattgagcacttgctcaaactccaatacgacattataggcatcaataacagg
gatttacacaccttaaaaaccgatattaaccacacgctagaattacgccccctgttgcct
aaagacgcgctcattatcagtgagtccggtatttattcgcatgcacaaatcaaagcccta
gccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaaggatttgaaa
aaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttacaaggattaaa
gacgctaaagccgtttataaaaaccatttcatttatgggggtttgatttttgaaaaatct
tcgccccgatacatcaagcctaaagaagccctaaagatcacaaaagcggttaaaaaactg
gattttgtgggcatgtttgtgaaagataagattaaaaaaatccaaaaaatcgctaaaaag
cttgatttaaaagcggtgcagctttatggctattcgcctaaaaaaatcgctcaattaaaa
aaagtgctccctaaaacttgtgcgatctggcaagtaataagcgtgatgaacgctaaagat
ttagcgcctaaaattaaagaagcctctctaatcttatacgacactaagggggataaaatg
ggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacgcctttcatg
ctagctggtgggcttaatttggataatattcaaaaagccttgaaagttgaagcgttgggg
ttggatttcaattccggtttagaaacaagtcccgggattaaaaataaggataaaatcaag
cgattagcccgaattttaagggagtattaa

DBGET integrated database retrieval system