KEGG   Helicobacter pylori G27: HPG27_1365Help
Entry
HPG27_1365        CDS       T00777                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpg  Helicobacter pylori G27
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478278..1479081
Genome map
AA seq 267 aa AA seqDB search
MHVFEVYPKVNIFLKILCKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAVYQAYKPETCFSQAKEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPMQKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtctttgaagtttatcctaaagtcaatatttttttaaagatcctttgcaaagaa
ggggcttatcataagctcatttctcgcatgtgtttagtcaaagacaagctcaaagacatt
attagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatctaaat
cagatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggc
gcagacaccaattttttcatctcgcaatacaaaagcgctaacgctacttcttatggcgaa
gtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcaccaaat
catgttttttgcagcactaaagccgtttatcaagcttataagcctgaaacttgtttttct
caagctaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttgcgatagaaac
ggattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggcatagaa
agcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctatgcaaaaagggggcgaatga

DBGET integrated database retrieval system