KEGG   Helicobacter pylori G27: HPG27_1365Help
Entry
HPG27_1365        CDS       T00777                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpg  Helicobacter pylori G27
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPG27_1365
Enzymes [BR:hpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPG27_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478278..1479081
Genome map
AA seq 267 aa AA seqDB search
MHVFEVYPKVNIFLKILCKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAVYQAYKPETCFSQAKEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPMQKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtctttgaagtttatcctaaagtcaatatttttttaaagatcctttgcaaagaa
ggggcttatcataagctcatttctcgcatgtgtttagtcaaagacaagctcaaagacatt
attagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatctaaat
cagatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggc
gcagacaccaattttttcatctcgcaatacaaaagcgctaacgctacttcttatggcgaa
gtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcaccaaat
catgttttttgcagcactaaagccgtttatcaagcttataagcctgaaacttgtttttct
caagctaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttgcgatagaaac
ggattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggcatagaa
agcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctatgcaaaaagggggcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system