KEGG   Helicobacter pylori G27: HPG27_194Help
Entry
HPG27_194         CDS       T00777                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpg  Helicobacter pylori G27
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPG27_194
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPG27_194
Enzymes [BR:hpg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPG27_194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215266..216432)
Genome map
AA seq 388 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECGENGVKNLFLYRIFNSPKEHA
EKEHAKEKHAKENVKPLHFCFAGHIDVVPPGDNWQSDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFLLSILLTSDEEGPGIFGTRLMLEKLKEKNLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGVQGHVAYPKKCQNPIDALASVLPLISGVHLDDGDEYFD
PSKLVITNLHAGLGANNVTPGSVEITFNARHSLKTTKESLKEYLEKVLKDLPHTLELESS
SSPFITTSHSKLTSVLKENILKTCRTTPLLNTKGGTSDARFFSAHGIEVVEFGAINDRIH
AIDERVSLKELELLEKVFLGVLEDLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaactctagaatgtggg
gaaaatggcgtgaaaaacctttttttataccgcatttttaactcccccaaagagcatgca
gaaaaagaacatgcaaaagaaaagcatgcaaaagaaaatgttaagcccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctggagataattggcaaagcgatccctttaaa
cccatcattaaagaggggtttttatacggccgtggggcacaagacatgaaggggggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaaccccttttttgctttctatt
ttactcacgagcgatgaagaaggaccagggatttttggcactaggcttatgttagaaaaa
ctcaaagaaaaaaatttgctaccccatatggcgattgtggctgaacccacttgtgaaaaa
gtcctaggcgatagcatcaaaattggccgaagaggctctattaatggcaaactcatttta
aaaggcgttcaagggcatgtggcttacccaaaaaaatgccaaaaccctattgatgcgctc
gcttcggttttgcctttgatttcaggagttcatttagacgatggcgatgaatattttgac
ccttcaaaattagtcatcaccaacttgcatgcagggttaggggctaataatgtgactcca
gggagcgtagaaattacctttaatgcgcgccattctttaaaaaccactaaagagagtttg
aaagaatatttagaaaaagttttaaaagatttgcctcacactttagaattagagtcaagc
agttcgcctttcatcacgacttctcattcaaagcttaccagcgttttaaaagaaaatatt
ttaaaaacatgccgcaccaccccccttttaaacaccaaaggaggcacgagcgatgcgcga
ttttttagcgctcatggcatagaagtggtggagtttggcgccattaatgacaggatccat
gccattgatgaaagggtgagcttgaaagaattagagcttttagaaaaggtgtttttgggg
gttttagaggatttgagcgagaaataa

DBGET integrated database retrieval system