KEGG   Helicobacter pylori G27: HPG27_255Help
Entry
HPG27_255         CDS       T00777                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpg01100  Metabolic pathways
hpg01110  Biosynthesis of secondary metabolites
hpg01130  Biosynthesis of antibiotics
hpg01230  Biosynthesis of amino acids
Module
hpg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPG27_255
Enzymes [BR:hpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPG27_255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACI27022
UniProt: B5ZA42
Position
279921..280478
Genome map
AA seq 185 aa AA seqDB search
MQEIGILDNLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGTPSVFDLEVLGLLRRHASSLIIHQDFFISHYQLLESLVQGS
DGVILDEKLLKEDLKGMVEFAWRLGLSVFVETHKQDYTHLKDLGVLGVLEISPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagataatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgcgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcacg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagctctttgatt
atccatcaggattttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagatgaaaagcttttgaaagaagatctaaaaggcatggtagaattt
gcttggcgtttgggcttgagcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaattagcccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system