KEGG   Helicobacter pylori G27: HPG27_255Help
Entry
HPG27_255         CDS       T00777                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpg  Helicobacter pylori G27
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPG27_255
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPG27_255
Enzymes [BR:hpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPG27_255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279921..280478
Genome map
AA seq 185 aa AA seqDB search
MQEIGILDNLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGTPSVFDLEVLGLLRRHASSLIIHQDFFISHYQLLESLVQGS
DGVILDEKLLKEDLKGMVEFAWRLGLSVFVETHKQDYTHLKDLGVLGVLEISPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagataatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgcgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcacg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagctctttgatt
atccatcaggattttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagatgaaaagcttttgaaagaagatctaaaaggcatggtagaattt
gcttggcgtttgggcttgagcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaattagcccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system