KEGG   Helicobacter pylori G27: HPG27_302Help
Entry
HPG27_302         CDS       T00777                                 

Definition
(GenBank) 5'-guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00230  Purine metabolism
hpg01100  Metabolic pathways
Module
hpg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPG27_302
Enzymes [BR:hpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPG27_302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 Thymidylate_kin AAA_17 MMR_HSR1 RNA_helicase ABC_tran RsgA_GTPase ADK AAA_22 AAA_5 dNK AAA_33 CPT Rad17 AAA_29 T2SSE Podovirus_Gp16 NTPase_1 Cytidylate_kin AAA_28 DUF1981 Zeta_toxin APS_kinase TsaE NACHT Mg_chelatase AAA_30
Motif
Other DBs
NCBI-ProteinID: ACI27068
UniProt: B5ZA88
Position
complement(334358..334978)
Genome map
AA seq 206 aa AA seqDB search
MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPREGEVDGLHYNFVSEEE
FKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSV
FISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILS
IAKTLVHRLKAFNFEKICKAWKNESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgattttaatttactcatcctttcaggccctagcggagcgggtaaaagcact
ctcacaaaatatttgcaagaaaaaatcccaaaaacccatttttccctttccaccaccaca
cgaaagcctagagagggcgaagttgatggcttgcattacaattttgtcagcgaagaagaa
ttcaaacaaggcatagaaaaagggcagtttttagaatgggcgatcgtgcataaccactat
tatggcacttctaaaatccctgtagaaaaagccttaaaagagggcaaaatcgtcattttt
gatattgatgtgcaagggcatgaaatccttaaaaagcattaccctaacgcatgttcagtg
tttattagcaccaaaaaccaagagattttaaaagagcgcttgcttttaagggggacggat
tctaaagagacgatagaaaagcgcttaatcaacgcttataaagaaatgcagtgcttggag
agctttgattacctcatcatcaatgaagatttagaaaaatccaaagaaatcatcttaagc
atcgctaaaactttagtccatcgcttgaaagcgtttaattttgaaaaaatatgcaaggct
tggaaaaacgaatccttataa

DBGET integrated database retrieval system