KEGG   Helicobacter pylori G27: HPG27_346Help
Entry
HPG27_346         CDS       T00777                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hpg  Helicobacter pylori G27
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hpg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hpg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378105..379028
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLSLDEIKLLLNKASVYANDFNAVSLETKEKMHNKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQTSSTSKGETLIDTFKNIHAMQPDAIITRHAFSSAPFKLA
EFSQCPLINAGSGMSAHPTQALLDLLTLYQHFGGLENLKGKKIAFIGDVKNSRVANSNIK
LLQRLGLEIMLCAPSSMLPSTPLRTTHNIEEAIAFADILMSLRTQTERHNAPIFASLKDY
GNTYCITQKRLSTHAKNKEIIILHPGPVHRDIDIESAVLEDKRSKVLEQVKNGVAMRMAV
LEFLLSD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgacacttgctccaaaccagcgatttaagcctagatgaaatcaag
cttttattgaacaaagcgagcgtttatgcgaacgattttaacgccgtatctttagagaca
aaagaaaaaatgcacaataaaatcatcgtggctttattttttgaaaattccaccagaacg
gtgtctagttttgaaatcgcaagcctaaggttgggggcaaaaatagtgaaattaaacatg
caaacgagctccacttcaaagggtgaaactttgatagacacttttaaaaatatccatgcc
atgcagcctgacgctatcatcacacggcatgctttttcaagcgcgccttttaaattggct
gaattttcacaatgccccttgattaacgcaggaagcggcatgagcgctcatcctacccaa
gcgttattagacttgctcaccctttatcagcattttggcggtttagaaaatttaaaaggg
aagaaaatcgcttttataggcgatgtgaaaaattccagagtggctaatagtaacattaaa
ttgctccaaagactagggcttgagatcatgctgtgtgctccaagctccatgctccctagc
actcctttaagaacgacgcacaacattgaagaagcgatagcgtttgcagacattttaatg
agtttgaggacccaaaccgaacggcacaacgcacccatttttgcgagcttgaaagattat
ggcaacacttattgcatcacccaaaaacgcctaagcactcacgctaaaaataaagagatc
attattttacacccaggcccggtgcatagggatattgatatagaaagcgcggtgttagaa
gacaagcgatctaaagtcttagagcaagtcaaaaacggcgtggcaatgcgcatggcggtg
ttggagtttttgctatcagattga

DBGET integrated database retrieval system