KEGG   Helicobacter pylori G27: HPG27_552Help
Entry
HPG27_552         CDS       T00777                                 

Definition
type IIIR-M system restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpg  Helicobacter pylori G27
Brite
Enzymes [BR:hpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HPG27_552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591285..594227
Genome map
AA seq 980 aa AA seqDB search
MIFEKQDYQQECINNIITLLDGFDFKRHDALNLKDCLSQFHAACEIPVKNLSGKLNVDVL
METGTGKTFTYLNLIFALHKAYGQNKFIIFVPRKAILESVKQNIRLTKDYFYLEFKRHLK
TYTYEGVKSPSNIINHYIKNQDELSVLLLTNSAIDKEGNILNKNSETLFNTKSIFENIAD
LKPISIIDEPHLLKGEAFGKYFGKIGTLYFRFGATFAKEKEHALSNVAFCLDSINAFRNY
LVKQIRIHSVMQDAQSPFLINADSKSAKIAFYKAGILKQITLSKGEDLGKINASFNGVSL
VKTTKDKAYLSDGATLEKASLKLTQDEISTLLEKAIDLHFEKEAFLFDQNIKALSLFFIP
KIEDFRQIDNKGAPFIKTEFERLYKLKRASILARENLSPSYREYLKRDFDESGNLRVHQG
YFSGDSIALNKGKKESSKENIEANDIKMILSEKEKLLSFQTPLRFIFSVWALQEGWDNPN
IFTLIKLANSTSETSRHQQVGRGLRIALNQEGKRVTHGFLKGNDNAFYKINYLDMLVSGE
EVGFIEGLQKEIEASSFIGVASALDREILAKLGLNERKINQFCDALETLNAVEFDETNNA
YKIIAPICETMQNNEERIKSFLSDEEYHAVLSAFKMAENPTNKRDQIINANQPPEKVKIR
QNLAKEFKELWQTINAQSQLSYQNIQKTKLIESIAKAFNESHVMCEAIIFESKRYNPQTN
RIITEQSSTLKIRDHANALQKEINALLLDFAKDERLPLKFTLELYNALNKEHFTNSPKKA
FKLLKGIIKDKLHENLLSCVSYGFCQNAFFNTAFDKTDPLYFEDGSPKNEIEKHKLGKYK
SVQTPSQNYLYETIIYDSKIEEEVSKEGVQKVENKSIEVFAKLPKFKIPTPYKNYEPDFA
YLIKDEKGTKIFFACETKGYEKESDIPKDEKRKIEYAKIFFETLSQNLKNAKKEIRVVFA
TRINKQDLLSALKNALKETP
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaaaagcaagactaccagcaagagtgtattaataacattatcacgctttta
gatggctttgattttaagcgccacgatgccttaaatctaaaagattgtttaagtcaattt
catgccgcatgcgaaattcctgtcaaaaatttaagcggcaagctcaatgttgatgtcttg
atggaaacaggcacgggcaagactttcacctacttgaatttgatctttgcgctccataag
gcttatgggcaaaataaattcatcatctttgtcccacgaaaagccattttggagtcggtt
aagcaaaatatccgccttacgaaagattatttttatttagaattcaaacgccacctgaaa
acctacacttatgaaggggttaaatcgccaagcaacattatcaatcattacattaaaaac
caagatgaactgagtgtcttgctcctcactaacagcgcgattgacaaggagggaaacata
ctcaataaaaacagcgaaaccctttttaacaccaaaagcatttttgaaaatatcgctgat
ttaaagcctatttccatcatagacgagccgcatttgcttaagggtgaagcgtttggtaag
tattttggtaaaataggcacgctttattttcgctttggggcgacttttgccaaagaaaaa
gagcatgctttaagcaatgttgccttttgtttggattcaatcaacgcgtttagaaattac
cttgtcaaacaaatccgcatccattctgtcatgcaagatgcgcaaagcccgtttttgatc
aatgcggattcaaaaagtgcaaaaattgccttttacaaagcgggcattcttaaacaaatc
acgctttcaaagggagaggatttaggcaaaattaacgcttcttttaacggcgttagcttg
gtcaaaaccaccaaagacaaggcttatttgagcgatggcgctacgcttgaaaaggcttct
ttaaaactcacgcaagatgaaatcagcactcttttagaaaaagccattgatttgcatttt
gaaaaagaggcgtttttatttgatcaaaacattaaagcgttaagcctgttttttatccca
aaaattgaggattttaggcaaattgataacaaaggcgcgccctttataaaaaccgaattt
gaaaggctttacaaactcaaacgcgcttcaattctagcaagggaaaatttatcgccaagc
tatagagaatatttgaaaagagattttgatgagagtggtaatttacgtgtccatcaaggc
tattttagcggcgatagcatagcgctcaataaaggcaaaaaagaaagcagcaaagaaaac
attgaagccaacgacattaaaatgattttaagcgaaaaagaaaaactgctttcatttcaa
acgcctttgcgttttatttttagcgtgtgggctttgcaagagggttgggataatccaaac
attttcacccttattaaacttgcaaactccactagcgaaacaagtcgccatcagcaagtg
ggacgcgggttaagaatcgcgcttaatcaagagggcaagcgcgttacgcatggattttta
aaaggcaatgacaacgccttttataaaataaactaccttgatatgctagtgagtggcgaa
gaagtgggttttatagagggtttgcaaaaagagattgaagcgagtagctttattggtgtg
gcaagcgcgctagacagagagattttagccaagttagggcttaatgaaagaaagatcaat
caattttgcgatgcattagaaacattaaacgccgtagaatttgacgaaaccaacaacgct
tacaaaatcattgcccctatttgcgagacgatgcaaaacaacgaagaaaggataaaaagc
tttttaagcgatgaagaatatcacgccgttttaagcgcttttaaaatggctgaaaatcca
accaacaagcgcgatcaaattataaacgctaaccaacctccagaaaaagtcaaaatccgc
caaaatttagctaaggaatttaaagaattgtggcaaaccatcaacgcacaaagccaatta
agctatcaaaatatccaaaaaaccaagctgatagaatctatcgccaaagcgtttaatgaa
agccatgtgatgtgtgaggcaatcatttttgaaagcaaaaggtataacccacaaaccaac
aggatcatcacagagcaatcaagcaccctaaaaatcagagaccacgctaacgctttacaa
aaagaaataaacgcgcttctgcttgactttgccaaagacgagcgcttacccttaaaattc
acgcttgaactctacaacgctttaaacaaagagcatttcacaaactcacccaaaaaagcc
tttaaattgcttaaaggcatcattaaagataagttgcatgaaaacttgctttcttgcgtg
agttatggattttgccaaaacgccttttttaacacggcttttgataaaaccgatccgctc
tattttgaagatggctcgcccaaaaatgagattgaaaaacacaaattaggtaaatacaaa
agcgtgcaaactccaagccaaaactatctttatgagacgatcatttatgattctaaaatt
gaagaagaagtgagtaaagagggcgtgcaaaaagtggaaaataaaagcatagaggttttt
gccaagctccctaaatttaaaatcccaacgccttataaaaactatgagcctgattttgct
tatttgattaaagatgaaaagggcacaaaaatcttttttgcttgcgaaaccaaaggttat
gaaaaagaaagcgatattccgaaagatgaaaagcgtaaaattgaatacgctaagatcttt
tttgaaacgctatctcaaaatttaaagaacgcaaaaaaagaaatacgagtcgtttttgcc
acacgcattaacaaacaagatttattgagcgcgcttaaaaacgcattaaaggaaacgcca
tga

DBGET integrated database retrieval system