KEGG   Helicobacter pylori Lithuania75: HPLT_00530Help
Entry
HPLT_00530        CDS       T01896                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_00530
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_00530
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPLT_00530
Enzymes [BR:hph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPLT_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95415..96869)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAVLNPNAPKGGLYTLERFETLQWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERVLFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEIYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKDDKTALETLKNSYNTPDSQRLDDLFERGIKYQEVLKLNEIKSSILLWL
ESLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcggta
ttaaaccccaacgccccaaaaggcgggctttacactttagagcgttttgaaacattacaa
tggcaagattgtttgaatctgagctataacgagttagtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattgacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaacctagcggtaggaaaaaatgaaaagtatttaatgctcgtttccacaagtggggat
accggtcctgcgactttagaaagtttggcgggcatgcctaacgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtttttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcgcgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagagacaggg
cgttacgatttaacccatcgctctttaaagcaaactttctcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttagcctttttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgcgttaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcctgtttgaaaacaatccaa
gaaatttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaaccaacgaaaaaacccttgtttccgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaaaaaagacgataaaaccgccctagaaacg
ctaaaaaacagctacaataccccggatagccagcgccttgatgatttatttgagagagga
atcaaataccaagaagttttaaaactcaatgagatcaaatcttctattcttttgtggtta
gaaagcctacattaa

DBGET integrated database retrieval system