KEGG   Helicobacter pylori Lithuania75: HPLT_00530Help
Entry
HPLT_00530        CDS       T01896                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_00530
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_00530
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPLT_00530
Enzymes [BR:hph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPLT_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95415..96869)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAVLNPNAPKGGLYTLERFETLQWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERVLFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEIYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKDDKTALETLKNSYNTPDSQRLDDLFERGIKYQEVLKLNEIKSSILLWL
ESLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcggta
ttaaaccccaacgccccaaaaggcgggctttacactttagagcgttttgaaacattacaa
tggcaagattgtttgaatctgagctataacgagttagtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattgacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaacctagcggtaggaaaaaatgaaaagtatttaatgctcgtttccacaagtggggat
accggtcctgcgactttagaaagtttggcgggcatgcctaacgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtttttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcgcgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagagacaggg
cgttacgatttaacccatcgctctttaaagcaaactttctcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttagcctttttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgcgttaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcctgtttgaaaacaatccaa
gaaatttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaaccaacgaaaaaacccttgtttccgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaaaaaagacgataaaaccgccctagaaacg
ctaaaaaacagctacaataccccggatagccagcgccttgatgatttatttgagagagga
atcaaataccaagaagttttaaaactcaatgagatcaaatcttctattcttttgtggtta
gaaagcctacattaa

DBGET integrated database retrieval system