KEGG   Helicobacter pylori Lithuania75: HPLT_00600Help
Entry
HPLT_00600        CDS       T01896                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hph00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112721..113359
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVTIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttca
gcacgcattggcaccaatcaatttgtgatcaacaaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcacgccctccttatagtttggcgtattctttgcgccacaaccggttgctccctaga
gattatttagggtatcgttctttgggcgaagaagtaacgatttttaaccccaaagattat
gacagctggcaagaaagagcggatacagaaattttacgccaattacaagagagcaaaaaa
tattttgttttcattaaagggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgacgatccacgattgagcgtgtaa

DBGET integrated database retrieval system