KEGG   Helicobacter pylori Lithuania75: HPLT_01015Help
Entry
HPLT_01015        CDS       T01896                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00010  Glycolysis / Gluconeogenesis
hph00051  Fructose and mannose metabolism
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
hph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPLT_01015 (tpiA)
   00051 Fructose and mannose metabolism
    HPLT_01015 (tpiA)
   00562 Inositol phosphate metabolism
    HPLT_01015 (tpiA)
Enzymes [BR:hph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPLT_01015 (tpiA)
Exosome [BR:hph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPLT_01015 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPLT_01015 (tpiA)
  Exosomal proteins of melanoma cells
   HPLT_01015 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU82645
UniProt: E8QMU9
Structure
PDB: 

Jmol
Position
191824..192528
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEELITREKGFKAVKEFLSEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtatttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgtattggcgaagaattgataaccagagagaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagtgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system