KEGG   Helicobacter pylori Lithuania75: HPLT_01205Help
Entry
HPLT_01205        CDS       T01896                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hph  Helicobacter pylori Lithuania75
Brite
Enzymes [BR:hph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPLT_01205
Secretion system [BR:hph02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPLT_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232694..233491
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSTLLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSEDVKLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNTANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcacgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttggtgagcgtgattgaa
aaacagaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtggtgagt
aaggatggtaatttagtcatagggcttagcaacatattctttagcaataaaagcgaagat
gtgaaattagttgcagaaaccaatcaaaaaatccaagcccttaacgccacccagcaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacactgcaaataaggataaaatcctttatattgtttccgatcccatgtgcccg
cattgccaaaaagagctcaccaaactcagggatcacttaaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttaatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaa
gtggaaaataccacgaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system