KEGG   Helicobacter pylori Lithuania75: HPLT_01420Help
Entry
HPLT_01420        CDS       T01896                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_01420
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPLT_01420
Enzymes [BR:hph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPLT_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274480..275022
Genome map
AA seq 180 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLGKLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFSWRLGLSVFVETHKPDYTHLKDLGVLGVLENSPHSYNQKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgttaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgcgtttttgtaacccctgatgaggttttaggaaagcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttgagcgtgtttgtagaaacccataagccagactacacccattta
aaagatttaggggttttaggcgtgttggaaaatagcccccattcttataatcaaaaaaaa
tag

DBGET integrated database retrieval system